ELK1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
MBL-CNA0789P
| Artikelname: |
ELK1 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: |
MBL-CNA0789P |
| Hersteller Artikelnummer: |
CNA0789P |
| Alternativnummer: |
MBL-CNA0789P |
| Hersteller: |
MBL |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human, Mouse, Rat |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 201-297 of human ELK1 (NP_005220.2). |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
ELK1 |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
45kDa |
| NCBI: |
2002 |
| UniProt: |
P19419 |
| Puffer: |
PBS with 0.05% proclin300,50% glycerol |
| Quelle: |
Rabbit |
| Reinheit: |
Affinity purification |
| Formulierung: |
PBS with 0.05% proclin300,50% glycerol |
| Sequenz: |
PSPLEACLEAEEAGLPLQVILTPPEAPNLKSEELNVEPGLGRALPPEVKVEGPKEELEVAGERGFVPETTKAEPEVPPQEGVPARLPAVVMDTAGQA |
| Target-Kategorie: |
ELK1 |
| Application Verdünnung: |
WB: WB,1:500 - 1:1000 |
