CD58 Rabbit mAb, Clone: [ARC2540], Unconjugated, Monoclonal
Artikelnummer:
MBL-CNA0806S
| Artikelname: |
CD58 Rabbit mAb, Clone: [ARC2540], Unconjugated, Monoclonal |
| Artikelnummer: |
MBL-CNA0806S |
| Hersteller Artikelnummer: |
CNA0806S |
| Alternativnummer: |
MBL-CNA0806S |
| Hersteller: |
MBL |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CD58 (P19256). |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
ag3, LFA3, LFA-3 |
| Klonalität: |
Monoclonal |
| Klon-Bezeichnung: |
[ARC2540] |
| Molekulargewicht: |
28kDa |
| NCBI: |
965 |
| UniProt: |
P19256 |
| Puffer: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
| Quelle: |
Rabbit |
| Reinheit: |
Affinity purification |
| Formulierung: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
| Sequenz: |
MVAGSDAGRALGVLSVVCLLHCFGFISCFSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDE |
| Target-Kategorie: |
CD58 |
| Application Verdünnung: |
WB: WB,1:500 - 1:1000 |
