MVD Rabbit mAb, Clone: [ARC2541], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA0813S
Artikelname: MVD Rabbit mAb, Clone: [ARC2541], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA0813S
Hersteller Artikelnummer: CNA0813S
Alternativnummer: MBL-CNA0813S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 250-350 of human MVD (P53602).
Konjugation: Unconjugated
Alternative Synonym: MPD, MDDase, POROK7, FP17780
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2541]
Molekulargewicht: 43kDa
NCBI: 4597
UniProt: P53602
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: PSFAQLTMKDSNQFHATCLDTFPPISYLNAISWRIIHLVHRFNAHHGDTKVAYTFDAGPNAVIFTLDDTVAEFVAAVWHGFPPGSNGDTFLKGLQVRPAPL
Target-Kategorie: MVD
Application Verdünnung: WB: WB,1:500 - 1:1000