SR-BI Rabbit mAb, Clone: [ARC0334], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA0827S
Artikelname: SR-BI Rabbit mAb, Clone: [ARC0334], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA0827S
Hersteller Artikelnummer: CNA0827S
Alternativnummer: MBL-CNA0827S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SR-BI (Q8WTV0).
Konjugation: Unconjugated
Alternative Synonym: CLA1, SRB1, CLA-1, SR-BI, CD36L1, HDLCQ6, HDLQTL6
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0334]
Molekulargewicht: 61kDa
Sensitivitaet: 0.5 mg/mL
NCBI: 949
UniProt: Q8WTV0
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MGCSAKARWAAGALGVAGLLCAVLGAVMIVMVPSLIKQQVLKNVRIDPSSLSFNMWKEIPIPFYLSVYFFDVMNPSEILKGEKPQVRERGPYVYREFRHK
Target-Kategorie: SCARB1
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200