PDK1/PDHK1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0834P
Artikelname: PDK1/PDHK1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0834P
Hersteller Artikelnummer: CNA0834P
Alternativnummer: MBL-CNA0834P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 337-436 of human PDK1/PDHK1 (NP_002601.1).
Konjugation: Unconjugated
Alternative Synonym: PDK1
Klonalität: Polyclonal
Molekulargewicht: 49kDa
NCBI: 5163
UniProt: Q15118
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: STAPRPRVETSRAVPLAGFGYGLPISRLYAQYFQGDLKLYSLEGYGTDAVIYIKALSTDSIERLPVYNKAAWKHYNTNHEADDWCVPSREPKDMTTFRSA
Target-Kategorie: PDK1
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200