DDIT3/CHOP Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0854S
Artikelname: DDIT3/CHOP Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0854S
Hersteller Artikelnummer: CNA0854S
Alternativnummer: MBL-CNA0854S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human DDIT3/CHOP (NP_004074.2).
Konjugation: Unconjugated
Alternative Synonym: CHOP, CEBPZ, CHOP10, CHOP-10, GADD153, AltDDIT3, C/EBPzeta
Klonalität: Polyclonal
Molekulargewicht: 19kDa
NCBI: 1649
UniProt: P35638
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEPAEVTSTSQSPHSPDSSQSSLAQEEEEEDQG
Target-Kategorie: DDIT3
Application Verdünnung: WB: WB,1:500 - 1:2000