RGMA Rabbit mAb, Clone: [ARC2546], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA0865S
Artikelname: RGMA Rabbit mAb, Clone: [ARC2546], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA0865S
Hersteller Artikelnummer: CNA0865S
Alternativnummer: MBL-CNA0865S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 350-450 of human RGMA (Q96B86).
Konjugation: Unconjugated
Alternative Synonym: RGM
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2546]
Molekulargewicht: 49kDa
NCBI: 56963
UniProt: Q96B86
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: TAPETFPYETAVAKCKEKLPVEDLYYQACVFDLLTTGDVNFTLAAYYALEDVKMLHSNKDKLHLYERTRDLPGRAAAGLPLAPRPLLGALVPLLALLPVFC
Target-Kategorie: RGMA
Application Verdünnung: WB: WB,1:500 - 1:1000