Islet1 Rabbit mAb, Clone: [ARC0511], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA0871S
Artikelname: Islet1 Rabbit mAb, Clone: [ARC0511], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA0871S
Hersteller Artikelnummer: CNA0871S
Alternativnummer: MBL-CNA0871S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Islet1 (P61371).
Konjugation: Unconjugated
Alternative Synonym: Isl-1, ISLET1
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0511]
Molekulargewicht: 39kDa
NCBI: 3670
UniProt: P61371
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: YAANPRPDALMKEQLVEMTGLSPRVIRVWFQNKRCKDKKRSIMMKQLQQQQPNDKTNIQGMTGTPMVAASPERHDGGLQANPVEVQSYQPPWKVLSDFALQ
Target-Kategorie: ISL1
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200