RPA70/RPA1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0874T
Artikelname: RPA70/RPA1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0874T
Hersteller Artikelnummer: CNA0874T
Alternativnummer: MBL-CNA0874T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-240 of human RPA70/RPA70/RPA1 (NP_002936.1).
Konjugation: Unconjugated
Alternative Synonym: HSSB, RF-A, RP-A, REPA1, RPA70, MST075, PFBMFT6
Klonalität: Polyclonal
Molekulargewicht: 68kDa
NCBI: 6117
UniProt: P27694
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MVGQLSEGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNEGLGQPQVAPPAPAASPAASSRPQPQNGSSGMGSTVSKAYGASKTFGKAAGPSLSHTSGGTQSKVVPIASLTPYQSKWTICARVTNKSQIRTWSNSRGEGKLFSLELVDESGEIRATAFNE
Target-Kategorie: RPA1
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:100