TRAF3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0875S
Artikelname: TRAF3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0875S
Hersteller Artikelnummer: CNA0875S
Alternativnummer: MBL-CNA0875S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TRAF3 (NP_003291.2).
Konjugation: Unconjugated
Alternative Synonym: CAP1, LAP1, CAP-1, CRAF1, IIAE5, CD40bp, RNF118
Klonalität: Polyclonal
Molekulargewicht: 64kDa
NCBI: 7187
UniProt: Q13114
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MESSKKMDSPGALQTNPPLKLHTDRSAGTPVFVPEQGGYKEKFVKTVEDKYKCEKCHLVLCSPKQTECGHRFCESCMAALLSSSSPKCTACQESIVKDKV
Target-Kategorie: TRAF3
Application Verdünnung: WB: WB,1:200 - 1:1000