PRKCSH Rabbit mAb, Clone: [ARC2549], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA0894S
Artikelname: PRKCSH Rabbit mAb, Clone: [ARC2549], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA0894S
Hersteller Artikelnummer: CNA0894S
Alternativnummer: MBL-CNA0894S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 429-528 of human PRKCSH (P14314).
Konjugation: Unconjugated
Alternative Synonym: GIIB, PCLD, PLD1, G19P1, PCLD1, PKCSH, AGE-R2, VASAP-60
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2549]
Molekulargewicht: 59kDa
NCBI: 5589
UniProt: P14314
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: PFKLVSQKPKLGGSPTSLGTWGSWIGPDHDKFSAMKYEQGTGCWQGPNRSTTVRLLCGKETMVTSTTEPSRCEYLMELMTPAACPEPPPEAPTEDDHDEL
Target-Kategorie: PRKCSH
Application Verdünnung: WB: WB,1:500 - 1:1000