ILK Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0901S
Artikelname: ILK Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0901S
Hersteller Artikelnummer: CNA0901S
Alternativnummer: MBL-CNA0901S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human ILK (NP_001014795.1).
Konjugation: Unconjugated
Alternative Synonym: P59, ILK-1, ILK-2, p59ILK, HEL-S-28
Klonalität: Polyclonal
Molekulargewicht: 51kDa
NCBI: 3611
UniProt: Q13418
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARINVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLVANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNGTLNKHSGIDFKQLNFLTKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECPRLRIFSHPNVLPVL
Target-Kategorie: ILK
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:100