EAAT2/SLC1A2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0910S
Artikelname: EAAT2/SLC1A2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0910S
Hersteller Artikelnummer: CNA0910S
Alternativnummer: MBL-CNA0910S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 495-574 of human EAAT2/EAAT2/SLC1A2 (NP_004162.2).
Konjugation: Unconjugated
Alternative Synonym: GLT1, HBGT, DEE41, EAAT2, GLT-1, EIEE41
Klonalität: Polyclonal
Molekulargewicht: 62kDa
NCBI: 6506
UniProt: P43004
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: HLSKSELDTIDSQHRVHEDIEMTKTQSIYDDMKNHRESNSNQCVYAAHNSVIVDECKVTLAANGKSADCSVEEEPWKREK
Target-Kategorie: SLC1A2
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200