CTNNBIP1 Rabbit mAb, Clone: [ARC2551], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA0914S
Artikelname: CTNNBIP1 Rabbit mAb, Clone: [ARC2551], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA0914S
Hersteller Artikelnummer: CNA0914S
Alternativnummer: MBL-CNA0914S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-81 of human CTNNBIP1 (Q9NSA3).
Konjugation: Unconjugated
Alternative Synonym: ICAT
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2551]
Molekulargewicht: 9kDa
NCBI: 56998
UniProt: Q9NSA3
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSIDQGAEDVVMAFSRSETEDRRQ
Target-Kategorie: CTNNBIP1
Application Verdünnung: WB: WB,1:500 - 1:1000