HES1 Rabbit mAb, Clone: [ARC0513], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA0925S
Artikelname: HES1 Rabbit mAb, Clone: [ARC0513], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA0925S
Hersteller Artikelnummer: CNA0925S
Alternativnummer: MBL-CNA0925S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, IP, WB
Spezies Reaktivität: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 181-280 of human HES1 (Q14469).
Konjugation: Unconjugated
Alternative Synonym: HHL, HRY, HES-1, bHLHb39
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0513]
Molekulargewicht: 30kDa
NCBI: 3280
UniProt: Q14469
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: FAPPPPLVPIPGGAAPPPGGAPCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSGTSVGPNAVSPSSGPSLTADSMWRPWRN
Target-Kategorie: HES1
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IP,1:100 - 1:500