Filamin A Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0927S
Artikelname: Filamin A Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0927S
Hersteller Artikelnummer: CNA0927S
Alternativnummer: MBL-CNA0927S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IP, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 2348-2647 of human Filamin A (NP_001104026.1).
Konjugation: Unconjugated
Alternative Synonym: FLN, FMD, MNS, OPD, ABPX, CSBS, CVD1, FGS2, FLN1, NHBP, OPD1, OPD2, XLVD, XMVD, FLN-A, ABP-280
Klonalität: Polyclonal
Molekulargewicht: 281kDa
NCBI: 2316
UniProt: P21333
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: NQPASFAVSLNGAKGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGVYLIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGNPAEFVVNTSNAGAGALSVTIDGPSKVKMDCQECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLVSNHSLHETSSVFVDSLTKATCAPQHGAPGPGPADASKVVAKGLGLSKAYVGQKSSFTVDCSKAGNNMLLVGVHGPRTPC
Target-Kategorie: FLNA
Application Verdünnung: WB: WB,1:500 - 1:2000|IP,1:50 - 1:100