NOTCH3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0929S
Artikelname: NOTCH3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0929S
Hersteller Artikelnummer: CNA0929S
Alternativnummer: MBL-CNA0929S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 751-850 of human NOTCH3 (NP_000426.2).
Konjugation: Unconjugated
Alternative Synonym: IMF2, LMNS, CASIL, CADASIL, CADASIL1
Klonalität: Polyclonal
Molekulargewicht: 244kDa
NCBI: 4854
UniProt: Q9UM47
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: SDGMGFHCTCPPGVQGRQCELLSPCTPNPCEHGGRCESAPGQLPVCSCPQGWQGPRCQQDVDECAGPAPCGPHGICTNLAGSFSCTCHGGYTGPSCDQDI
Target-Kategorie: NOTCH3
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200