NCF4/p40-phox Rabbit mAb, Clone: [ARC2553], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA0935S
Artikelname: NCF4/p40-phox Rabbit mAb, Clone: [ARC2553], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA0935S
Hersteller Artikelnummer: CNA0935S
Alternativnummer: MBL-CNA0935S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, IP, WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 240-339 of human NCF4/p40-phox (Q15080).
Konjugation: Unconjugated
Alternative Synonym: NCF, CGD3, P40PHOX, SH3PXD4
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2553]
Molekulargewicht: 39kDa
Sensitivitaet: 0.8 mg/mL
NCBI: 4689
UniProt: Q15080
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: LRCYYYEDTISTIKDIAVEEDLSSTPLLKDLLELTRREFQREDIALNYRDAEGDLVRLLSDEDVALMVRQARGLPSQKRLFPWKLHITQKDNYRVYNTMP
Target-Kategorie: NCF4
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IP,1:500 - 1:1000