MARCKS Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0936T
Artikelname: MARCKS Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0936T
Hersteller Artikelnummer: CNA0936T
Alternativnummer: MBL-CNA0936T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MARCKS (NP_002347.5).
Konjugation: Unconjugated
Alternative Synonym: MACS, 80K-L, PKCSL, PRKCSL
Klonalität: Polyclonal
Molekulargewicht: 32kDa
NCBI: 4082
UniProt: P29966
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MGAQFSKTAAKGEAAAERPGEAAVASSPSKANGQENGHVKVNGDASPAAAESGAKEELQANGSAPAADKEEPAAAGSGAASPSAAEKGEPAAAAAPEAGA
Target-Kategorie: MARCKS
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200