HFE Rabbit mAb, Clone: [ARC2554], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA0937S
Artikelname: HFE Rabbit mAb, Clone: [ARC2554], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA0937S
Hersteller Artikelnummer: CNA0937S
Alternativnummer: MBL-CNA0937S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 249-348 of human HFE (Q30201).
Konjugation: Unconjugated
Alternative Synonym: HH, HFE1, HLA-H, MVCD7, TFQTL2
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2554]
Molekulargewicht: 40kDa
NCBI: 3077
UniProt: Q30201
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: KEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIWEPSPSGTLVIGVISGIAVFVVILFIGILFIILRKRQGSRGAMGHYVLAERE
Target-Kategorie: HFE
Application Verdünnung: WB: WB,1:500 - 1:1000