VPS24 Rabbit mAb, Clone: [ARC1849], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA0941S
Artikelname: VPS24 Rabbit mAb, Clone: [ARC1849], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA0941S
Hersteller Artikelnummer: CNA0941S
Alternativnummer: MBL-CNA0941S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 65-220 of human VPS24 (Q9Y3E7).
Konjugation: Unconjugated
Alternative Synonym: NEDF, VPS24, CGI-149
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1849]
Molekulargewicht: 25kDa
NCBI: 51652
UniProt: Q9Y3E7
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: KEMIRSRKAVSKLYASKAHMNSVLMGMKNQLAVLRVAGSLQKSTEVMKAMQSLVKIPEIQATMRELSKEMMKAGIIEEMLEDTFESMDDQEEMEEEAEMEIDRILFEITAGALGKAPSKVTDALPEPEPPGAMAASEDEEEEEEALEAMQSRLATL
Target-Kategorie: CHMP3
Application Verdünnung: WB: WB,1:500 - 1:1000