PARP1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0942T
Artikelname: PARP1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0942T
Hersteller Artikelnummer: CNA0942T
Alternativnummer: MBL-CNA0942T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human PARP1 (NP_001609.2).
Konjugation: Unconjugated
Alternative Synonym: PARP, PARS, PPOL, ADPRT, ARTD1, ADPRT1, PARP-1, ADPRT 1, pADPRT-1, Poly-PARP
Klonalität: Polyclonal
Molekulargewicht: 113kDa
NCBI: 142
UniProt: P09874
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: PGVKSEGKRKGDEVDGVDEVAKKKSKKEKDKDSKLEKALKAQNDLIWNIKDELKKVCSTNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSG
Target-Kategorie: PARP1
Application Verdünnung: WB: WB,1:1000 - 1:5000|IF/ICC,1:50 - 1:200