FABP5 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0947S
Artikelname: FABP5 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0947S
Hersteller Artikelnummer: CNA0947S
Alternativnummer: MBL-CNA0947S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human FABP5 (NP_001435.1).
Konjugation: Unconjugated
Alternative Synonym: EFABP, KFABP, E-FABP, PAFABP, PA-FABP
Klonalität: Polyclonal
Molekulargewicht: 15kDa
NCBI: 2171
UniProt: Q01469
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEW
Target-Kategorie: FABP5
Application Verdünnung: WB: WB,1:500 - 1:2000