[KO Validated] ErbB3/HER3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0950P
Artikelname: [KO Validated] ErbB3/HER3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0950P
Hersteller Artikelnummer: CNA0950P
Alternativnummer: MBL-CNA0950P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1275-1342 of human ErbB3/HER3 (NP_001973.2).
Konjugation: Unconjugated
Alternative Synonym: HER3, FERLK, LCCS2, VSCN1, ErbB-3, c-erbB3, erbB3-S, MDA-BF-1, c-erbB-3, p180-ErbB3, p45-sErbB3, p85-sErbB3
Klonalität: Polyclonal
Molekulargewicht: 148kDa
NCBI: 2065
UniProt: P21860
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: DYAAMGACPASEQGYEEMRAFQGPGHQAPHVHYARLKTLRSLEATDSAFDNPDYWHSRLFPKANAQRT
Target-Kategorie: ERBB3
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200