NeuN Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0951T
Artikelname: NeuN Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0951T
Hersteller Artikelnummer: CNA0951T
Alternativnummer: MBL-CNA0951T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of NeuN (NP_001076044.1).
Konjugation: Unconjugated
Alternative Synonym: FOX3, NEUN, FOX-3, HRNBP3
Klonalität: Polyclonal
Molekulargewicht: 34kDa
NCBI: 146713
UniProt: A6NFN3
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MAQPYPPAQYPPPPQNGIPAEYAPPPPHPTQDYSGQTPVPTEHGMTLYTPAQTHPEQPGSEASTQPIAGTQTVPQTDEAAQTDSQPLHPSDPTEKQQPKR
Target-Kategorie: RBFOX3
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200