Olig1 Rabbit mAb, Clone: [ARC1850], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA0953S
Artikelname: Olig1 Rabbit mAb, Clone: [ARC1850], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA0953S
Hersteller Artikelnummer: CNA0953S
Alternativnummer: MBL-CNA0953S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 172-271 of human Olig1 (Q8TAK6).
Konjugation: Unconjugated
Alternative Synonym: BHLHB6, BHLHE21
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1850]
Molekulargewicht: 28kDa
NCBI: 116448
UniProt: Q8TAK6
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: RRALGEGAGPAAPRLLLAGLPLLAAAPGSVLLAPGAVGPPDALRPAKYLSLALDEPPCGQFALPGGGAGGPGLCTCAVCKFPHLVPASLGLAAVQAQFSK
Target-Kategorie: OLIG1
Application Verdünnung: WB: WB,1:500 - 1:1000