ERAB/HSD17B10 Rabbit mAb, Clone: [ARC1852], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA0959S
Artikelname: ERAB/HSD17B10 Rabbit mAb, Clone: [ARC1852], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA0959S
Hersteller Artikelnummer: CNA0959S
Alternativnummer: MBL-CNA0959S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 162-261 of human ERAB/HSD17B10 (Q99714).
Konjugation: Unconjugated
Alternative Synonym: ABAD, CAMR, ERAB, HCD2, MHBD, HADH2, MRPP2, MRX17, MRX31, SCHAD, MRXS10, SDR5C1, HSD10MD, 17b-HSD10, DUPXp11.22
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1852]
Molekulargewicht: 27kDa
NCBI: 3028
UniProt: Q99714
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: QVGQAAYSASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLNGEVIRLDGAIRMQP
Target-Kategorie: HSD17B10
Application Verdünnung: WB: WB,1:500 - 1:1000