gamma-Catenin Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0963S
Artikelname: gamma-Catenin Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0963S
Hersteller Artikelnummer: CNA0963S
Alternativnummer: MBL-CNA0963S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IP, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human gamma-Catenin (NP_002221.1).
Konjugation: Unconjugated
Alternative Synonym: PG, DP3, PDGB, PKGB, CTNNG, DPIII
Klonalität: Polyclonal
Molekulargewicht: 82kDa
NCBI: 3728
UniProt: P14923
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MEVMNLMEQPIKVTEWQQTYTYDSGIHSGANTCVPSVSSKGIMEEDEACGRQYTLKKTTTYTQGVPPSQGDLEYQMSTTARAKRVREAMCPGVSGEDSSLLLATQVEGQATNLQRLAEPSQLLKSAIVHLINYQDDAELATRALPELTKLLNDEDPVVVTKAAMIVNQLSKKEASRRALMGSPQLVAAVVRTMQNTSDLDTARCTTSILHNLSHHREGLLAIFKSGGIPALVRMLSSPVESVLFYAITTLHNLL
Target-Kategorie: JUP
Application Verdünnung: WB: WB,1:500 - 1:2000|IP,1:50 - 1:100