WASP Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0978S
Artikelname: WASP Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0978S
Hersteller Artikelnummer: CNA0978S
Alternativnummer: MBL-CNA0978S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 60-250 of human WASPP (NP_000368.1).
Konjugation: Unconjugated
Alternative Synonym: THC, IMD2, SCNX, THC1, WASP, WASPA
Klonalität: Polyclonal
Molekulargewicht: 53kDa
NCBI: 7454
UniProt: P42768
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: GAEHWTKEHCGAVCFVKDNPQKSYFIRLYGLQAGRLLWEQELYSQLVYSTPTPFFHTFAGDDCQAGLNFADEDEAQAFRALVQEKIQKRNQRQSGDRRQLPPPPTPANEERRGGLPPLPLHPGGDQGGPPVGPLSLGLATVDIQNPDITSSRYRGLPAPGPSPADKKRSGKKKISKADIGAPSGFKHVSHV
Target-Kategorie: WAS
Application Verdünnung: WB: WB,1:500 - 1:2000