MyD88 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0980T
Artikelname: MyD88 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0980T
Hersteller Artikelnummer: CNA0980T
Alternativnummer: MBL-CNA0980T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human MyD88 (NP_001166038.2).
Konjugation: Unconjugated
Alternative Synonym: WM1, IMD68, MYD88D
Klonalität: Polyclonal
Molekulargewicht: 33kDa
NCBI: 4615
UniProt: Q99836
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: LAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEKPLQVAAVDSSVPRTAELAGITTL
Target-Kategorie: MYD88
Application Verdünnung: WB: WB,1:100 - 1:500|IF/ICC,1:50 - 1:200