PI3 Kinase p110 beta Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0982S
Artikelname: PI3 Kinase p110 beta Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0982S
Hersteller Artikelnummer: CNA0982S
Alternativnummer: MBL-CNA0982S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 410-600 of human PI3 Kinase p110 beta (NP_006210.1).
Konjugation: Unconjugated
Alternative Synonym: PI3K, PIK3C1, P110BETA, PI3KBETA
Klonalität: Polyclonal
Molekulargewicht: 123kDa
NCBI: 5291
UniProt: P42338
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: KVKTKKSTKTINPSKYQTIRKAGKVHYPVAWVNTMVFDFKGQLRTGDIILHSWSSFPDELEEMLNPMGTVQTNPYTENATALHVKFPENKKQPYYYPPFDKIIEKAAEIASSDSANVSSRGGKKFLPVLKEILDRDPLSQLCENEMDLIWTLRQDCREIFPQSLPKLLLSIKWNKLEDVAQLQALLQIWPK
Target-Kategorie: PIK3CB
Application Verdünnung: WB: WB,1:500 - 1:1000