MSH6 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0983T
Artikelname: MSH6 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0983T
Hersteller Artikelnummer: CNA0983T
Alternativnummer: MBL-CNA0983T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MSH6 (NP_000170.1).
Konjugation: Unconjugated
Alternative Synonym: GTBP, HSAP, p160, GTMBP, MSH-6, HNPCC5, LYNCH5, MMRCS3
Klonalität: Polyclonal
Molekulargewicht: 153kDa
NCBI: 2956
UniProt: P52701
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MSRQSTLYSFFPKSPALSDANKASARASREGGRAAAAPGASPSPGGDAAWSEAGPGPRPLARSASPPKAKNLNGGLRRSVAPAAPTSCDFSPGDLVWAKM
Target-Kategorie: MSH6
Application Verdünnung: WB: WB,1:500 - 1:1000