NEK8 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0984P
Artikelname: NEK8 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0984P
Hersteller Artikelnummer: CNA0984P
Alternativnummer: MBL-CNA0984P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 270-390 of human NEK8 (NP_835464.1).
Konjugation: Unconjugated
Alternative Synonym: JCK, NPHP9, RHPD2, NEK12A
Klonalität: Polyclonal
Molekulargewicht: 75kDa
NCBI: 284086
UniProt: Q86SG6
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: GSVRMRRAEKSVAPSNTGSRTTSVRCRGIPRGPVRPAIPPPLSSVYAWGGGLGTPLRLPMLNTEVVQVAAGRTQKAGVTRSGRLILWEAPPLGAGGGSLLPGAVEQPQPQFISRFLEGQSG
Target-Kategorie: NEK8
Application Verdünnung: WB: WB,1:100 - 1:500