SYT1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0992T
Artikelname: SYT1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0992T
Hersteller Artikelnummer: CNA0992T
Alternativnummer: MBL-CNA0992T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 84-157 of human SYT1 (NP_005630.1).
Konjugation: Unconjugated
Alternative Synonym: P65, SYT, BAGOS, SVP65
Klonalität: Polyclonal
Molekulargewicht: 48kDa
NCBI: 6857
UniProt: P21579
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: LFKKKNKKKGKEKGGKNAINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNN
Target-Kategorie: SYT1
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200