Hexokinase II Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0994P
Artikelname: Hexokinase II Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0994P
Hersteller Artikelnummer: CNA0994P
Alternativnummer: MBL-CNA0994P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human Hexokinase II (NP_000180.2).
Konjugation: Unconjugated
Alternative Synonym: HKII, HXK2
Klonalität: Polyclonal
Molekulargewicht: 102kDa
NCBI: 3099
UniProt: P52789
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: MIASHLLAYFFTELNHDQVQKVDQYLYHMRLSDETLLEISKRFRKEMEKGLGATTHPTAAVKMLPTFVRSTPDGTEHGEFLALDLGGTNFRVLWVKVTDNGLQKVEMENQIYAIPEDIMR
Target-Kategorie: HK2
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200