Cyclin H Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0995S
Artikelname: Cyclin H Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0995S
Hersteller Artikelnummer: CNA0995S
Alternativnummer: MBL-CNA0995S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IP, WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-323 of human Cyclin H (NP_001230.1).
Konjugation: Unconjugated
Alternative Synonym: CAK, p34, p37, CycH
Klonalität: Polyclonal
Molekulargewicht: 38kDa
NCBI: 902
UniProt: P51946
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MYHNSSQKRHWTFSSEEQLARLRADANRKFRCKAVANGKVLPNDPVFLEPHEEMTLCKYYEKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYPILENPEILRKTADDFLNRIALTDAYLLYTPSQIALTAILSSASRAGITMESYLSESLMLKENRTCLSQLLDIMKS
Target-Kategorie: CCNH
Application Verdünnung: WB: WB,1:500 - 1:2000|IP,1:50 - 1:200