ID2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA0996P
Artikelname: ID2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA0996P
Hersteller Artikelnummer: CNA0996P
Alternativnummer: MBL-CNA0996P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 75-134 of human ID2 (NP_002157.2).
Konjugation: Unconjugated
Alternative Synonym: GIG8, ID2A, ID2H, bHLHb26
Klonalität: Polyclonal
Molekulargewicht: 15kDa
NCBI: 3398
UniProt: Q02363
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: LQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG
Target-Kategorie: ID2
Application Verdünnung: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200