GEN1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10001S
Artikelname: GEN1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10001S
Hersteller Artikelnummer: CNA10001S
Alternativnummer: MBL-CNA10001S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 669-908 of human GEN1 (NP_872431.3).
Konjugation: Unconjugated
Alternative Synonym: Gen
Klonalität: Polyclonal
Molekulargewicht: 103kDa
NCBI: 348654
UniProt: Q17RS7
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: LQDLPLKERIFTKLSYPQDNLQPDVNLKTLSILSVKESCIANSGSDCTSHLSKDLPGIPLQNESRDSKILKGDQLLQEDYKVNTSVPYSVSNTVVKTCNVRPPNTALDHSRKVDMQTTRKILMKKSVCLDRHSSDEQSAPVFGKAKYTTQRMKHSSQKHNSSHFKESGHNKLSSPKIHIKETEQCVRSYETAENEESCFPDSTKSSLSSLQCHKKENNSGTCLDSPLPLRQRLKLRFQST
Target-Kategorie: GEN1
Application Verdünnung: WB: WB,1:500 - 1:2000