PAPD7 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10017S
Artikelname: PAPD7 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10017S
Hersteller Artikelnummer: CNA10017S
Alternativnummer: MBL-CNA10017S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 303-542 of human PAPD7 (NP_008930.1).
Konjugation: Unconjugated
Alternative Synonym: LAK1, POLK, POLS, TRF4, LAK-1, PAPD7, TRF41, TRF4-1, TUTASE5
Klonalität: Polyclonal
Molekulargewicht: 85kDa
NCBI: 11044
UniProt: Q5XG87
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: GSKAHPSPGMDSRIKIKERIATCNGEQTQNREPESPYGQRLTLSLSSPQLLSSGSSASSVSSLSGSDVDSDTPPCTTPSVYQFSLQAPAPLMAGLPTALPMPSGKPQPTTSRTLIMTTNNQTRFTIPPPTLGVAPVPCRQAGVEGTASLKAVHHMSSPAIPSASPNPLSSPHLYHKQHNGMKLSMKGSHGHTQGGGYSSVGSGGVRPPVGNRGHHQYNRTGWRRKKHTHTRDSLPVSLSR
Target-Kategorie: TENT4A
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200