RTN4RL1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10021S
Artikelname: RTN4RL1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10021S
Hersteller Artikelnummer: CNA10021S
Alternativnummer: MBL-CNA10021S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 220-420 of human RTN4RL1 (NP_848663.1).
Konjugation: Unconjugated
Alternative Synonym: NgR3, NGRH2
Klonalität: Polyclonal
Molekulargewicht: 49kDa
NCBI: 146760
UniProt: Q86UN2
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: LRRLTTLFLFNNSLSELQGECLAPLGALEFLRLNGNPWDCGCRARSLWEWLQRFRGSSSAVPCVSPGLRHGQDLKLLRAEDFRNCTGPASPHQIKSHTLTTTDRAARKEHHSPHGPTRSKGHPHGPRPGHRKPGKNCTNPRNRNQISKAGAGKQAPELPDYAPDYQHKFSFDIMPTARPKRKGKCARRTPIRAPSGVQQAS
Target-Kategorie: RTN4RL1
Application Verdünnung: WB: WB,1:1000 - 1:4000