COPE Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10047S
Artikelname: COPE Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10047S
Hersteller Artikelnummer: CNA10047S
Alternativnummer: MBL-CNA10047S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-308 of human COPE (NP_009194.2).
Konjugation: Unconjugated
Alternative Synonym: epsilon-COP
Klonalität: Polyclonal
Molekulargewicht: 34kDa
NCBI: 11316
UniProt: O14579
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MAPPAPGPASGGSGEVDELFDVKNAFYIGSYQQCINEAQRVKLSSPERDVERDVFLYRAYLAQRKFGVVLDEIKPSSAPELQAVRMFADYLAHESRRDSIVAELDREMSRSVDVTNTTFLLMAASIYLHDQNPDAALRALHQGDSLECTAMTVQILLKLDRLDLARKELKRMQDLDEDATLTQLATAWVSLATGGEKLQDAYYIFQEMADKCSPTLLLLNGQAACHMAQGRWEAAEGLLQEALDKDSGYPETLV
Target-Kategorie: COPE
Application Verdünnung: WB: WB,1:500 - 1:1000