IL17RA Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10052S
Artikelname: IL17RA Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10052S
Hersteller Artikelnummer: CNA10052S
Alternativnummer: MBL-CNA10052S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 697-866 of human IL17RA (NP_055154.3).
Konjugation: Unconjugated
Alternative Synonym: CD217, IL17R, IMD51, CANDF5, CDw217, IL-17RA, hIL-17R
Klonalität: Polyclonal
Molekulargewicht: 96kDa
NCBI: 23765
UniProt: Q96F46
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: AGEGEACPLLGSPGAGRNSVLFLPVDPEDSPLGSSTPMASPDLLPEDVREHLEGLMLSLFEQSLSCQAQGGCSRPAMVLTDPHTPYEEEQRQSVQSDQGYISRSSPQPPEGLTEMEEEEEEEQDPGKPALPLSPEDLESLRSLQRQLLFRQLQKNSGWDTMGSESEGPSA
Target-Kategorie: IL17RA
Application Verdünnung: WB: WB,1:1000 - 1:4000