DDR2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10060S
Artikelname: DDR2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10060S
Hersteller Artikelnummer: CNA10060S
Alternativnummer: MBL-CNA10060S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 290-400 of human DDR2 (NP_001014796.1).
Konjugation: Unconjugated
Alternative Synonym: TKT, WRCN, MIG20a, NTRKR3, TYRO10
Klonalität: Polyclonal
Molekulargewicht: 97kDa
NCBI: 4921
UniProt: Q16832
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: NMFAKGVKIFKEVQCYFRSEASEWEPNAISFPLVLDDVNPSARFVTVPLHHRMASAIKCQYHFADTWMMFSEITFQSDAAMYNNSEALPTSPMAPTTYDPMLKVDDSNTRI
Target-Kategorie: DDR2
Application Verdünnung: WB: WB,1:500 - 1:2000