SCN1B Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10071S
Artikelname: SCN1B Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10071S
Hersteller Artikelnummer: CNA10071S
Alternativnummer: MBL-CNA10071S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 19-160 of human SCN1B (NP_950238.1).
Konjugation: Unconjugated
Alternative Synonym: DEE52, ATFB13, BRGDA5, EIEE52, GEFSP1
Klonalität: Polyclonal
Molekulargewicht: 25kDa
NCBI: 6324
UniProt: Q07699
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: GGCVEVDSETEAVYGMTFKILCISCKRRSETNAETFTEWTFRQKGTEEFVKILRYENEVLQLEEDERFEGRVVWNGSRGTKDLQDLSIFITNVTYNHSGDYECHVYRLLFFENYEHNTSVVKKIHIEVVDKGESGAACPFTV
Target-Kategorie: SCN1B
Application Verdünnung: WB: WB,1:500 - 1:2000