CD53 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
MBL-CNA10079S
| Artikelname: |
CD53 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: |
MBL-CNA10079S |
| Hersteller Artikelnummer: |
CNA10079S |
| Alternativnummer: |
MBL-CNA10079S |
| Hersteller: |
MBL |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human, Mouse |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 100-180 of human CD53 (NP_000551.1). |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
MOX44, TSPAN25 |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
24kDa |
| NCBI: |
963 |
| UniProt: |
P19397 |
| Puffer: |
PBS with 0.02% sodium azide,50% glycerol |
| Quelle: |
Rabbit |
| Reinheit: |
Affinity purification |
| Formulierung: |
PBS with 0.02% sodium azide,50% glycerol |
| Sequenz: |
AILLFVYEQKLNEYVAKGLTDSIHRYHSDNSTKAAWDSIQSFLQCCGINGTSDWTSGPPASCPSDRKVEGCYAKARLWFHS |
| Target-Kategorie: |
CD53 |
| Application Verdünnung: |
WB: WB,1:1000 - 1:4000 |
