PCDH15 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10086S
Artikelname: PCDH15 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10086S
Hersteller Artikelnummer: CNA10086S
Alternativnummer: MBL-CNA10086S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 160-400 of human PCDH15 (NP_001136235.1).
Konjugation: Unconjugated
Alternative Synonym: USH1F, CDHR15, DFNB23
Klonalität: Polyclonal
Molekulargewicht: 216kDa
NCBI: 65217
UniProt: Q96QU1
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: TVNELTPVGTTIFTGFSGDNGATDIDDGPNGQIEYVIQYNPDDPTSNDTFEIPLMLTGNIVLRKRLNYEDKTRYFVIIQANDRAQNLNERRTTTTTLTVDVLDGDDLGPMFLPCVLVPNTRDCRPLTYQAAIPELRTPEELNPIIVTPPIQAIDQDRNIQPPSDRPGILYSILVGTPEDYPRFFHMHPRTAELSLLEPVNRDFHQKFDLVIKAEQDNGHPLPAFAGLHIEILDENNQSPYF
Target-Kategorie: PCDH15
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:100 - 1:200