TRPC5 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10089P
Artikelname: TRPC5 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10089P
Hersteller Artikelnummer: CNA10089P
Alternativnummer: MBL-CNA10089P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 800-900 of human TRPC5 (NP_036603.1).
Konjugation: Unconjugated
Alternative Synonym: TRP5, PPP1R159
Klonalität: Polyclonal
Molekulargewicht: 111kDa
NCBI: 7224
UniProt: Q9UL62
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: NLGCKKKTCHGPPLIRTMPRSSGAQGKSKAESSSKRSFMGPSLKKLGLLFSKFNGHMSEPSSEPMYTISDGIVQQHCMWQDIRYSQMEKGKAEACSQSEIN
Target-Kategorie: TRPC5
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200