IL36R Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10090S
Artikelname: IL36R Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10090S
Hersteller Artikelnummer: CNA10090S
Alternativnummer: MBL-CNA10090S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-116 of human IL36R (NP_003845.2).
Konjugation: Unconjugated
Alternative Synonym: IL-36R, IL1RRP2, IL-1Rrp2, IL1R-rp2
Klonalität: Polyclonal
Molekulargewicht: 65kDa
NCBI: 8808
UniProt: Q9HB29
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MWSLLLCGLSIALPLSVTADGCKDIFMKNEILSASQPFAFNCTFPPITSGEVSVTWYKNSSKIPVSKIIQSRIHQDETWILFLPMEWGDSGVYQCVIKGRDSCHRIHVNLTVFEKH
Target-Kategorie: IL1RL2
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200