alpha-Smooth Muscle Actin (ACTA2) Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1011P
Artikelname: alpha-Smooth Muscle Actin (ACTA2) Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1011P
Hersteller Artikelnummer: CNA1011P
Alternativnummer: MBL-CNA1011P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-124 of human alpha-Smooth Muscle Actin (ACTA2) (NP_001135417.1).
Konjugation: Unconjugated
Alternative Synonym: ACTSA
Klonalität: Polyclonal
Molekulargewicht: 42kDa
NCBI: 59
UniProt: P62736
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQI
Target-Kategorie: ACTA2
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200