ZP2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA10126S
Artikelname: ZP2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA10126S
Hersteller Artikelnummer: CNA10126S
Alternativnummer: MBL-CNA10126S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 651-745 of human ZP2 (NP_003451.1).
Konjugation: Unconjugated
Alternative Synonym: ZPA, Zp-2, OOMD6, OZEMA6
Klonalität: Polyclonal
Molekulargewicht: 82kDa
NCBI: 7783
UniProt: Q05996
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: KMTVSLPGPILLLSDDSSFRGVGSSDLKASGSSGEKSRSETGEEVGSRGAMDTKGHKTAGDVGSKAVAAVAAFAGVVATLGFIYYLYEKRTVSNH
Target-Kategorie: ZP2
Application Verdünnung: WB: WB,1:1000 - 1:4000|IF/ICC,1:50 - 1:200